General Information

  • ID:  hor004647
  • Uniprot ID:  Q06JG4
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 16D10
  • Gene name:  16D10
  • Organism:  Meloidogyne hapla (Root-knot nematode worm)
  • Family:  CLV3/ESR signal peptide family
  • Source:  animal
  • Expression:  Highly expressed exclusively within the subventral esophageal gland cell during syncytium formation in host plants.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Meloidogyne (genus), Meloidogyninae (subfamily), Meloidogynidae (family), Tylenchoidea (superfamily), Tylenchomorpha (infraorder), Tylenchina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0030154 cell differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0030430 host cell cytoplasm; GO:0043655 host extracellular space

Sequence Information

  • Sequence:  GKKPSGPNPGGNN
  • Length:  13
  • Propeptide:  MFTNSIKNLIIYLMPLMVTLMLLSVSFVDAGKKPSGPNPGGNN
  • Signal peptide:  MFTNSIKNLIIYLMPLMVTLMLLSVSFVDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a role in the differentiation or division of feeding cells (syncytia) induced in plant roots during infection. Promotes host root growth.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q06JG4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004647_AF2.pdbhor004647_ESM.pdb

Physical Information

Mass: 143752 Formula: C50H82N18O18
Absent amino acids: ACDEFHILMQRTVWY Common amino acids: G
pI: 10.81 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 0
Hydrophobicity: -196.15 Boman Index: -3066
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 1246.15 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA